Antibodies

There are several Nav1.1 antibodies available from commercial sources. All of the following information compares the antibody properties against the protein sequence for human full-length Nav1.1 based on Accession Number P35498.

Abcam

  • Type:  polyclonal
  • Reactivity: rabbit anti-rat Nav1.1
  • AA sequence: EEQKKYYNAMKKLGSKKP
  • Position:   
    • raised against: 1502-1519 of  rat Nav1.1 (P04774)
    • human Nav1.1[full]: 1502-1519 of human Nav1.1 (100 % match)
    • mouse Nav1.1[full]: not yet checked
  • Topology: L3
  • Catalog number: AB24820
  • Other: WARNING - likely cross reactivity with human Nav1.9 based on 100 % sequence match (NM_014139), other paralogs not checked

AbD Serotec

  • does not carry a Nav1.1 antibody

Alomone Labs

  • Type:  polyclonal
  • Reactivity: rabbit anti-rat Nav1.1
  • AA sequence: TASEHSREPSAAGRLSD
  • Position: 
    • raised against: 465-481 of  rat Nav1.1 (P04774)
    • mouse  (not checked yet)
    • human (not checked yet)
  • Topology: L1
  • Catalog number: ASC-001

Life Span Biosciences

  • Type: polyclonal
  • Reactivity: rabbit anti-rat/mouse/human
  • AA sequence: n/a
  • Position: n/a
  • Topology: n/a
  • Catalog number: LS-C143
  • Other: No longer available.

Millipore

Nav1.1 only:

  • Type: polyclonal
  • Reactivity: rabbit anti-rat Nav1.1
  • AA sequence: TASEHSREPSAAGRLSD
  • Position: 
    • raised against: 465-481 of  rat Nav1.1 (P04774)
    • mouse  not checked, yet
    • human not checked, yet
  • Topology: L1
  • Catalog number: AB5204
  • Other: technically identical to Alomone  antibody

Pan (all Navs):

  • Type: polyclonal
  • Reactivity: rabbit anti-rat Nav1.1-9 (suppposedly all Nav1.x isoforms)
  • AA sequence: TEEQKKYYNAMKKLGSKK
  • Position:
    • raised against: 1501-1518 of  rat Nav1.1 (P04774)
    • human orthologs not checked, yet
    • rat paralogs not checked, yet
  • Topology: L3
  • Catalog number: AB5210

NeuroMab

  • Type:  monoclonal
  • Reactivity: mouse anti-rat Nav1.1
  • AA sequence: HLLKRTVKQASFTYNKNKLKGGANLLVKEDMIIDRINENSITEKTDLTMSTAACPPSYDR
    VTKPIVEKHEQEGKDEKAKGK
  • Position:   
    • raised against: 1929-2009 of  rat Nav1.1 (P04774)
    • mouse: 98% identity (80/81 amino acids identical)
    • human: 97% identity (79/81 amino acids identical)
  • Topology: very end of C-terminus
  • Catalog number: K74_71

Sigma

  •  Type: ?
  • Reactivity: rabbit anti-rat Nav1.1
  • AA sequence: n/a
  • Position:
    • raised against: 465-481 of  rat Nav1.1 (P04774)?
    •  mouse  not checked, yet
    • human not checked, yet
  • Topology: probably L1
  • Catalog number: S4936
  • Other: additional N-terminal lysine and tyrosine, conjugated to KLH